PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof001274
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 98aa    MW: 10561.9 Da    PI: 9.9239
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Sof#S17285719PU_refUnigeneView CDS
PUT-157a-Saccharum_officinarum-75414PU_unrefplantGDBView CDS
PUT-157a-Saccharum_officinarum-75413PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.33.5e-084172132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     +g+WT+eEd +lv  v+++G ++W+  a+  g
        Sof001274 41 KGPWTEEEDAQLVWFVRLFGERRWDFLAKVSG 72
                     79***********************9999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.61E-83671IPR009057Homeodomain-like
PROSITE profilePS500906.7713674IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.6E-84074IPR009057Homeodomain-like
PfamPF002492.4E-64172IPR001005SANT/Myb domain
CDDcd001671.22E-64374No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MATPAAASMC GSKSKTKLQG GGERXSKGSG GGNSPPAAMR KGPWTEEEDA QLVWFVRLFG  60
ERRWDFLAKV SGLRGGGCLP KHAYIHIHVY GYKCMLGD
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.17721e-165bud| leaf| root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439162.16e-27hypothetical protein SORBIDRAFT_09g001590
TrEMBLC5YYM17e-27C5YYM1_SORBI; Putative uncharacterized protein Sb09g001590
STRINGSb09g001590.12e-26(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.14e-14myb domain protein 48